(data stored in ACNUC7421 zone)

EMBL: CP000859.PE384

CP000859.PE384       Location/Qualifiers
FT   CDS             complement(444062..444691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0384"
FT                   /product="protein of unknown function DUF205"
FT                   /note="PFAM: protein of unknown function DUF205; KEGG:
FT                   gme:Gmet_3020 protein of unknown function DUF205"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66194"
FT                   /db_xref="GOA:A8ZT30"
FT                   /db_xref="InterPro:IPR003811"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZT30"
FT                   /protein_id="ABW66194.1"
FT                   /translation="MDGQTILKIFLCTAGAFVLGSVPVGLVLTKLFSSKDIRTQGSGNI
FT                   GATNVARVAGARLGLITLALDLLKGALPVAAAGLMVPSTGEPAMALAGLAAVAGHCYPV
FT                   FSGFTGGGKGVATACGVFLVAAPWACLVALVVFLAAVAGFKRVSLGSILAALSLPAGTW
FT                   FFYGTGPVAAAAATVGLLVVARHRANISRLLAGTEPPFFKKPGQDR"
     MDGQTILKIF LCTAGAFVLG SVPVGLVLTK LFSSKDIRTQ GSGNIGATNV ARVAGARLGL        60
     ITLALDLLKG ALPVAAAGLM VPSTGEPAMA LAGLAAVAGH CYPVFSGFTG GGKGVATACG       120
     VFLVAAPWAC LVALVVFLAA VAGFKRVSLG SILAALSLPA GTWFFYGTGP VAAAAATVGL       180
     LVVARHRANI SRLLAGTEPP FFKKPGQDR                                         209
//

If you have problems or comments...

PBIL Back to PBIL home page