(data stored in ACNUC7421 zone)

EMBL: CP000859.PE386

CP000859.PE386       Location/Qualifiers
FT   CDS             445209..445601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0386"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   rci:LRC474 putative phenylacetic acid degradation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66196"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZT32"
FT                   /protein_id="ABW66196.1"
FT                   /translation="METPIISAVNKDRFVKEIGIELVTVSAGYAKTRMTVEPRHLNGLD
FT                   LGHGGAVFTLADYAFAAASNSHGVDAVAINITMSYFKAARAGDELTAEAKEIALSRKIG
FT                   TYAISVFNQNQDTVAFMQGTAFRKTP"
     METPIISAVN KDRFVKEIGI ELVTVSAGYA KTRMTVEPRH LNGLDLGHGG AVFTLADYAF        60
     AAASNSHGVD AVAINITMSY FKAARAGDEL TAEAKEIALS RKIGTYAISV FNQNQDTVAF       120
     MQGTAFRKTP                                                              130
//

If you have problems or comments...

PBIL Back to PBIL home page