(data stored in ACNUC7421 zone)

EMBL: CP000859.PE389

CP000859.PE389       Location/Qualifiers
FT   CDS             447704..448603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0389"
FT                   /product="membrane-bound lytic murein transglycosylase
FT                   B-like protein"
FT                   /note="KEGG: sfu:Sfum_3035 membrane-bound lytic murein
FT                   transglycosylase B-like"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66199"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031304"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZT35"
FT                   /protein_id="ABW66199.1"
FT                   /translation="MRFFSFILQLLLPALLLGVAGCTAPPAPPVYVDFETAAPFDRLCA
FT                   KLEKDGFDGQVLRRYYTHPDVAFEQAGTALFFHHSESKLNYDQFLKTASLNRAREYLQA
FT                   QGRWLTAAQNTYTVDKEVITAILLVETRFGAYLGTRPAFNILSSMASLADPAMEAEFWQ
FT                   SIEKTTTFTPEAYNKRVRDKSKWAYNELKAFLAYVEKENIENPVSLKSSYAGAMGISQF
FT                   MPSNILKLGVDGDNDGRVDLFTHPDAIFSVASFLAHHGWKPGLDHQAAYKVLLNYNYSR
FT                   PYAETVLKIRERLKAGPS"
     MRFFSFILQL LLPALLLGVA GCTAPPAPPV YVDFETAAPF DRLCAKLEKD GFDGQVLRRY        60
     YTHPDVAFEQ AGTALFFHHS ESKLNYDQFL KTASLNRARE YLQAQGRWLT AAQNTYTVDK       120
     EVITAILLVE TRFGAYLGTR PAFNILSSMA SLADPAMEAE FWQSIEKTTT FTPEAYNKRV       180
     RDKSKWAYNE LKAFLAYVEK ENIENPVSLK SSYAGAMGIS QFMPSNILKL GVDGDNDGRV       240
     DLFTHPDAIF SVASFLAHHG WKPGLDHQAA YKVLLNYNYS RPYAETVLKI RERLKAGPS        299
//

If you have problems or comments...

PBIL Back to PBIL home page