(data stored in ACNUC7421 zone)

EMBL: CP000859.PE390

CP000859.PE390       Location/Qualifiers
FT   CDS             448625..448843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66200"
FT                   /db_xref="GOA:A8ZT36"
FT                   /db_xref="InterPro:IPR027379"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZT36"
FT                   /protein_id="ABW66200.1"
FT                   /translation="MSPITITIIAVGLLAWLLTCWALIDVAGRDFGGIEKKAAWGFVAF
FT                   IPFVGWLIYLVIGRPKSTPPKAGPDPS"
     MSPITITIIA VGLLAWLLTC WALIDVAGRD FGGIEKKAAW GFVAFIPFVG WLIYLVIGRP        60
     KSTPPKAGPD PS                                                            72
//

If you have problems or comments...

PBIL Back to PBIL home page