(data stored in ACNUC7421 zone)

EMBL: CP000859.PE391

CP000859.PE391       Location/Qualifiers
FT   CDS             448840..449562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0391"
FT                   /product="biotin--acetyl-CoA-carboxylase ligase"
FT                   /EC_number="6.3.4.15"
FT                   /note="KEGG: bce:BC1537 biotin operon repressor /
FT                   biotin--[acetyl-CoA-carboxylase] synthetase; TIGRFAM:
FT                   biotin--acetyl-CoA-carboxylase ligase; PFAM: biotin protein
FT                   ligase domain protein; biotin/lipoate A/B protein ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66201"
FT                   /db_xref="GOA:A8ZT37"
FT                   /db_xref="InterPro:IPR003142"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZT37"
FT                   /protein_id="ABW66201.1"
FT                   /translation="MKIQQATLHHLATTESTMDVARNLALQGCPHFTVVVADTQTGGRG
FT                   RMDRTWHSDPGGLYMTLVLKPDMPAADGLKLTFLASLTLAQTVRRCCDIDAGVKWPNDI
FT                   LVKEKKLAGLLSEMQATGSRIDFVNIGIGINVNNDPARFEPGATSIKAATGATFSREGL
FT                   LDEFLGALKTGLQNTSLPSVIQQWKTLAVSLGRPVTVVTPRETVTGIAEDVNESGALLV
FT                   RMSDGDLREICYGDCFHR"
     MKIQQATLHH LATTESTMDV ARNLALQGCP HFTVVVADTQ TGGRGRMDRT WHSDPGGLYM        60
     TLVLKPDMPA ADGLKLTFLA SLTLAQTVRR CCDIDAGVKW PNDILVKEKK LAGLLSEMQA       120
     TGSRIDFVNI GIGINVNNDP ARFEPGATSI KAATGATFSR EGLLDEFLGA LKTGLQNTSL       180
     PSVIQQWKTL AVSLGRPVTV VTPRETVTGI AEDVNESGAL LVRMSDGDLR EICYGDCFHR       240
//

If you have problems or comments...

PBIL Back to PBIL home page