(data stored in ACNUC7421 zone)

EMBL: CP000859.PE395

CP000859.PE395       Location/Qualifiers
FT   CDS             455692..457065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0395"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pst:PSPTO_2820 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66205"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZT41"
FT                   /protein_id="ABW66205.1"
FT                   /translation="MNFNPDKTEYPSVAPQGDDGAVETEMPTMKISDFAAQFGCVPLTP
FT                   ADNPKIQAFYNSMAMTSEKFSVHTKKEPDYFRFLAYAADNHHVFGYPNAQGELEGMVSL
FT                   IVRPCYIGGRPDRVGHFLDLRFKRRKERTIKGDWKELGLGFTRSGSRVEETEGCRIYHG
FT                   SYITTNIYATASIGKDAHAKAGQKKAEKPAPAPERKAPPVPPEKTPAAPAPAPEAFRVS
FT                   NLAAYQAINIYARKPWKILSLGSFGKSREKLVVTQGTEKDLEPLKAFLDRQNQPKTFGY
FT                   IYAGPSGELERRLRRWDGLSMSSFFIARDLSGKILGAFGAFDPGRGRQLYIDALPPEKE
FT                   RLAKLGAMAGLKVPRPNENIDILYLTSLELDHDLAPDLRLSVFDRLLSALFRSGLPRRY
FT                   HIVSFCDYNKQSLLEVVSGGYMYDATPVLLYQLHSPDATEVYRESDMVLPPGHEMVLM"
     MNFNPDKTEY PSVAPQGDDG AVETEMPTMK ISDFAAQFGC VPLTPADNPK IQAFYNSMAM        60
     TSEKFSVHTK KEPDYFRFLA YAADNHHVFG YPNAQGELEG MVSLIVRPCY IGGRPDRVGH       120
     FLDLRFKRRK ERTIKGDWKE LGLGFTRSGS RVEETEGCRI YHGSYITTNI YATASIGKDA       180
     HAKAGQKKAE KPAPAPERKA PPVPPEKTPA APAPAPEAFR VSNLAAYQAI NIYARKPWKI       240
     LSLGSFGKSR EKLVVTQGTE KDLEPLKAFL DRQNQPKTFG YIYAGPSGEL ERRLRRWDGL       300
     SMSSFFIARD LSGKILGAFG AFDPGRGRQL YIDALPPEKE RLAKLGAMAG LKVPRPNENI       360
     DILYLTSLEL DHDLAPDLRL SVFDRLLSAL FRSGLPRRYH IVSFCDYNKQ SLLEVVSGGY       420
     MYDATPVLLY QLHSPDATEV YRESDMVLPP GHEMVLM                                457
//

If you have problems or comments...

PBIL Back to PBIL home page