(data stored in ACNUC7421 zone)

EMBL: CP000859.PE398

CP000859.PE398       Location/Qualifiers
FT   CDS             complement(459063..459893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0398"
FT                   /product="oxidoreductase of the aldo/keto reductase
FT                   family-like protein"
FT                   /note="KEGG: pai:PAE2929 aldo-keto reductase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66208"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZT44"
FT                   /protein_id="ABW66208.1"
FT                   /translation="MEQTIQTAHGSFAKGVLGRTGLSVGRLGLAASYGAPPAAFEEAFE
FT                   RGCNYFYIGSGRRRANMKTAIRNICENGHREHLVVAVQTYARFGLLTETLFRRNLRSMG
FT                   LAHADILMLGWHNRRPAQRLMDMALRLKQNGLCRFIGMSGHSRGLFVQLTKEGVFDLFH
FT                   VRYNAAHRGAETETFPFLKGDSRPGVVSYTATRWGHLLKSEKMPEGEPPLRASDCYRFA
FT                   MSHPAVDVCLCGPSNMEQMREALTALDLGPLSEAEMERARRVGDHVHRHGGGFF"
     MEQTIQTAHG SFAKGVLGRT GLSVGRLGLA ASYGAPPAAF EEAFERGCNY FYIGSGRRRA        60
     NMKTAIRNIC ENGHREHLVV AVQTYARFGL LTETLFRRNL RSMGLAHADI LMLGWHNRRP       120
     AQRLMDMALR LKQNGLCRFI GMSGHSRGLF VQLTKEGVFD LFHVRYNAAH RGAETETFPF       180
     LKGDSRPGVV SYTATRWGHL LKSEKMPEGE PPLRASDCYR FAMSHPAVDV CLCGPSNMEQ       240
     MREALTALDL GPLSEAEMER ARRVGDHVHR HGGGFF                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page