(data stored in ACNUC7421 zone)

EMBL: CP000859.PE403

CP000859.PE403       Location/Qualifiers
FT   CDS             complement(464078..464404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0403"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pca:Pcar_1472 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66213"
FT                   /db_xref="GOA:A8ZT49"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZT49"
FT                   /protein_id="ABW66213.1"
FT                   /translation="MKKCPFCAEAIADEAVKCKHCGEFLDAEARAFFEKKKQPWYFRTS
FT                   FITIAVLCVGPLALPLIWWRPETSRVYKISLTIIILVVSWLAFDITMKSLESLGEYYRL
FT                   LDTL"
     MKKCPFCAEA IADEAVKCKH CGEFLDAEAR AFFEKKKQPW YFRTSFITIA VLCVGPLALP        60
     LIWWRPETSR VYKISLTIII LVVSWLAFDI TMKSLESLGE YYRLLDTL                    108
//

If you have problems or comments...

PBIL Back to PBIL home page