(data stored in ACNUC7421 zone)

EMBL: CP000859.PE408

CP000859.PE408       Location/Qualifiers
FT   CDS             469645..470103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0408"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66218"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTF4"
FT                   /protein_id="ABW66218.1"
FT                   /translation="MPEDKKKEKVLHARISQDLEEQIRKEAGSLGVSVSNLVRNILSNT
FT                   FDLVENIVTDSADISRSARRRSASPVDGTRPSGPVAPDPVSESGRVVAWQEAIMNLNAV
FT                   CSQCNTILEKGSRAAIAVVEGTGPRPALCLTCLKEITHEDQNRSDNNE"
     MPEDKKKEKV LHARISQDLE EQIRKEAGSL GVSVSNLVRN ILSNTFDLVE NIVTDSADIS        60
     RSARRRSASP VDGTRPSGPV APDPVSESGR VVAWQEAIMN LNAVCSQCNT ILEKGSRAAI       120
     AVVEGTGPRP ALCLTCLKEI THEDQNRSDN NE                                     152
//

If you have problems or comments...

PBIL Back to PBIL home page