(data stored in ACNUC7421 zone)

EMBL: CP000859.PE409

CP000859.PE409       Location/Qualifiers
FT   CDS             470225..471601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0409"
FT                   /product="ABC-1 domain protein"
FT                   /note="PFAM: ABC-1 domain protein; KEGG: gvi:gll4412
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66219"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTF5"
FT                   /protein_id="ABW66219.1"
FT                   /translation="MGDILRDSFAVAGEAEAVYARAWDRAASVNAAIRSAPRFTRLFSD
FT                   LVRIVASYRIHSVKSRFLSDAEAAQALEALHQKNARRIYDLCVEMRGGLIKIGQFASTY
FT                   TNALPPAYIEYLGRLQDRVPPVPYKAIARRIESEFGRPAEQVFARVDPEPIAAASLAQV
FT                   HPAELHDGTRVVIKVQMPDIENTAEIDLTAFTIAADLTNDLFPALGLSEISRALADSVK
FT                   KELDYRQELANILRFNRQTVDDPRVVAPKVYPGLSTQRILTMEKLEGEHLIPFLEAAAP
FT                   DRRNRLLALIAESFCSQIVTHGFFHADPHPGNMFVLPGDRLGLIDFGCVEHFSAGTYAL
FT                   YMEMISAILSRDAESMARLFESMGFSAGAGAGAPLREMATDFIELLMLDPDQSLADVDT
FT                   TQKLTRGLELIKKYPGIRVPRHFVLLGRVLLTLGGIMMRYNPDINVFMLMVDQMGKNKL
FT                   "
     MGDILRDSFA VAGEAEAVYA RAWDRAASVN AAIRSAPRFT RLFSDLVRIV ASYRIHSVKS        60
     RFLSDAEAAQ ALEALHQKNA RRIYDLCVEM RGGLIKIGQF ASTYTNALPP AYIEYLGRLQ       120
     DRVPPVPYKA IARRIESEFG RPAEQVFARV DPEPIAAASL AQVHPAELHD GTRVVIKVQM       180
     PDIENTAEID LTAFTIAADL TNDLFPALGL SEISRALADS VKKELDYRQE LANILRFNRQ       240
     TVDDPRVVAP KVYPGLSTQR ILTMEKLEGE HLIPFLEAAA PDRRNRLLAL IAESFCSQIV       300
     THGFFHADPH PGNMFVLPGD RLGLIDFGCV EHFSAGTYAL YMEMISAILS RDAESMARLF       360
     ESMGFSAGAG AGAPLREMAT DFIELLMLDP DQSLADVDTT QKLTRGLELI KKYPGIRVPR       420
     HFVLLGRVLL TLGGIMMRYN PDINVFMLMV DQMGKNKL                               458
//

If you have problems or comments...

PBIL Back to PBIL home page