(data stored in ACNUC7421 zone)

EMBL: CP000859.PE413

CP000859.PE413       Location/Qualifiers
FT   CDS             474524..475873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0413"
FT                   /product="MATE efflux family protein"
FT                   /note="TIGRFAM: MATE efflux family protein; PFAM: multi
FT                   antimicrobial extrusion protein MatE; KEGG: dde:Dde_2418
FT                   MATE efflux family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66223"
FT                   /db_xref="GOA:A8ZTF9"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTF9"
FT                   /protein_id="ABW66223.1"
FT                   /translation="MFNHVPRLLRLAFPLILSSSAVMTMQIIDTIVLSWHSAEAVAAMG
FT                   PSSLAVILFQGFLYGIAAYAGTFVAHSHGRGDSMGVKKSTWMGIHAALFSGLAALIAAW
FT                   PLARLFLLMGHDPLVARYEMTYFWICMAGSFFPVAGGALAGWLSGIGRTLAITWVMLFA
FT                   FTINAVLTWALVLGRCGLPQMGIAGAAIGTVTAEMISASLFTILFARAGGFGEAAARRF
FT                   EWPAFRHFLLLAVPVGLRISGELVAWTLFLVIIGRLGVAELAASSIAFRINGLAFFPAI
FT                   GLAQAAGILVGQARGAGKDHDVPAIAWQSLAVGEAWMLAMALLFALAPAPLMSVFAGFG
FT                   PESAQIVAAGILILKFVALYCILDAANIIIGWVLAAAGDTRWLAWAYCASSGVFLALLW
FT                   LVDRTMPGLVTEWTLATIFIGTTAVIWMVRFQSGAWQKARVLRETVVPTV"
     MFNHVPRLLR LAFPLILSSS AVMTMQIIDT IVLSWHSAEA VAAMGPSSLA VILFQGFLYG        60
     IAAYAGTFVA HSHGRGDSMG VKKSTWMGIH AALFSGLAAL IAAWPLARLF LLMGHDPLVA       120
     RYEMTYFWIC MAGSFFPVAG GALAGWLSGI GRTLAITWVM LFAFTINAVL TWALVLGRCG       180
     LPQMGIAGAA IGTVTAEMIS ASLFTILFAR AGGFGEAAAR RFEWPAFRHF LLLAVPVGLR       240
     ISGELVAWTL FLVIIGRLGV AELAASSIAF RINGLAFFPA IGLAQAAGIL VGQARGAGKD       300
     HDVPAIAWQS LAVGEAWMLA MALLFALAPA PLMSVFAGFG PESAQIVAAG ILILKFVALY       360
     CILDAANIII GWVLAAAGDT RWLAWAYCAS SGVFLALLWL VDRTMPGLVT EWTLATIFIG       420
     TTAVIWMVRF QSGAWQKARV LRETVVPTV                                         449
//

If you have problems or comments...

PBIL Back to PBIL home page