(data stored in ACNUC7421 zone)

EMBL: CP000859.PE42

CP000859.PE42        Location/Qualifiers
FT   CDS             complement(50587..51408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0042"
FT                   /product="pantoate--beta-alanine ligase"
FT                   /EC_number="6.3.2.1"
FT                   /note="KEGG: sat:SYN_00420 pantoate--beta-alanine ligase;
FT                   TIGRFAM: pantoate--beta-alanine ligase;
FT                   cytidyltransferase-related domain; PFAM:
FT                   Pantoate-beta-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65852"
FT                   /db_xref="GOA:A8ZRT5"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR042176"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRT5"
FT                   /protein_id="ABW65852.1"
FT                   /translation="MQAHSDRMRRQGKTIAFVPTMGFLHEGHLSLLETGKAHGDHLVLS
FT                   IFVNPTQFAAGEDFASYPKSFEKDAQAAENQGVDVLFAPEATGLYEPGYETYVSLESLP
FT                   NHLCGIFRPAHFRGVATVVAKLFNIVKPHVAIFGEKDFQQLAVIRRMARDMNFDIKIMG
FT                   APIVREPDGLAMSSRNTYLKPEQRPAALSLYKSLVLARQMVAAGETGAAAIIEAARNLI
FT                   AGFSDTAIDYVAICDPDTLDDMDSLDRPALMALAVRVGTCRLIDNMMLVRP"
     MQAHSDRMRR QGKTIAFVPT MGFLHEGHLS LLETGKAHGD HLVLSIFVNP TQFAAGEDFA        60
     SYPKSFEKDA QAAENQGVDV LFAPEATGLY EPGYETYVSL ESLPNHLCGI FRPAHFRGVA       120
     TVVAKLFNIV KPHVAIFGEK DFQQLAVIRR MARDMNFDIK IMGAPIVREP DGLAMSSRNT       180
     YLKPEQRPAA LSLYKSLVLA RQMVAAGETG AAAIIEAARN LIAGFSDTAI DYVAICDPDT       240
     LDDMDSLDRP ALMALAVRVG TCRLIDNMML VRP                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page