(data stored in ACNUC7421 zone)

EMBL: CP000859.PE421

CP000859.PE421       Location/Qualifiers
FT   CDS             complement(484267..486432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0421"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; cadmium-translocating P-type
FT                   ATPase; heavy metal translocating P-type ATPase; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; Heavy metal
FT                   transport/detoxification protein; E1-E2 ATPase-associated
FT                   domain protein; KEGG: mta:Moth_2203 heavy
FT                   metal-(Cd/Co/Hg/Pb/Zn)-translocating P-type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66231"
FT                   /db_xref="GOA:A8ZTG7"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTG7"
FT                   /protein_id="ABW66231.1"
FT                   /translation="METVQEKRFRVQNLDCAACAAKIERELQNTEGVEAAVVDFANLTL
FT                   HLRAADISKALAAVARIEPDVKIESTLQDSEGDAHESTEAGNFRKQVGIIVIAGIIFAI
FT                   HLFFEDQLHQRPWAWVEYPIVIAAYLLAGWSVLIGALRTLRRGQFFDENVLMVIATTGA
FT                   MAIHALSEAVGVMLFFKVGELLQDMAVSKSRRSVRGLLAARPNRALLKTEGGLKETSPE
FT                   KVKVGEIILVKPGEKVALDGTVIEGVSQVDTSPLTGEPVPVQTRPGDTVLAGSINTASA
FT                   LTVRVTKPFEASSIARVLELVESAAARKAATEKFITTFARYYTPVVVAIAAAIALVPPL
FT                   LINDAQFSTWIYRALVLLVISCPCALVVSIPLGYFGGIGRASRSGILIKGSMFIDALSK
FT                   VKTVVFDKTGTLTRGVFTVDRVVTDNGFSSDQVLQMAAAVELHSDHPIGKSIVEAMTSK
FT                   GLAIDESLVSNHVAISGKGVKAVFDGKSIAVGNDALLHERQIDHGKCDFDSTVAHVVVD
FT                   NQYAGHILIGDQLKPDAKLAMERLRSDGVSKLVMLTGDNACAAASVAKALNLDQFHAEL
FT                   LPEDKVRIFEQILAETKEDGKVAFVGDGINDAPVLARADVGVAMGALGSDAAIETADVV
FT                   LMTDAPAKMADAVSIAKNTRKIVLQNIVLALTVKGIFILFGSFGLATMWEAVFADMGTA
FT                   LLALLNATRAFRGYPSLKEVHVKNASV"
     METVQEKRFR VQNLDCAACA AKIERELQNT EGVEAAVVDF ANLTLHLRAA DISKALAAVA        60
     RIEPDVKIES TLQDSEGDAH ESTEAGNFRK QVGIIVIAGI IFAIHLFFED QLHQRPWAWV       120
     EYPIVIAAYL LAGWSVLIGA LRTLRRGQFF DENVLMVIAT TGAMAIHALS EAVGVMLFFK       180
     VGELLQDMAV SKSRRSVRGL LAARPNRALL KTEGGLKETS PEKVKVGEII LVKPGEKVAL       240
     DGTVIEGVSQ VDTSPLTGEP VPVQTRPGDT VLAGSINTAS ALTVRVTKPF EASSIARVLE       300
     LVESAAARKA ATEKFITTFA RYYTPVVVAI AAAIALVPPL LINDAQFSTW IYRALVLLVI       360
     SCPCALVVSI PLGYFGGIGR ASRSGILIKG SMFIDALSKV KTVVFDKTGT LTRGVFTVDR       420
     VVTDNGFSSD QVLQMAAAVE LHSDHPIGKS IVEAMTSKGL AIDESLVSNH VAISGKGVKA       480
     VFDGKSIAVG NDALLHERQI DHGKCDFDST VAHVVVDNQY AGHILIGDQL KPDAKLAMER       540
     LRSDGVSKLV MLTGDNACAA ASVAKALNLD QFHAELLPED KVRIFEQILA ETKEDGKVAF       600
     VGDGINDAPV LARADVGVAM GALGSDAAIE TADVVLMTDA PAKMADAVSI AKNTRKIVLQ       660
     NIVLALTVKG IFILFGSFGL ATMWEAVFAD MGTALLALLN ATRAFRGYPS LKEVHVKNAS       720
     V                                                                       721
//

If you have problems or comments...

PBIL Back to PBIL home page