(data stored in ACNUC7421 zone)

EMBL: CP000859.PE423

CP000859.PE423       Location/Qualifiers
FT   CDS             complement(487247..489253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0423"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: protein kinase; SMART: tyrosine protein
FT                   kinase; serine/threonine protein kinase; KEGG:
FT                   rxy:Rxyl_2282 serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66233"
FT                   /db_xref="GOA:A8ZTG9"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTG9"
FT                   /protein_id="ABW66233.1"
FT                   /translation="MELKAHDMTTTCKTTLKVGDVLNNRWVILGFIDKGGMGEVYRAHQ
FT                   TNLNRDVAIKVVSREWLESIDEGDEEAETLVQRFRREVQAMAQIRHPNILQVFDHDAIT
FT                   VKKGDQDKSMEYIAMEYIPGGSLRDTMSDEGFYPEEDLIKTWVRRYFLPVLAGVMALHE
FT                   NGIVHRDLKPENIFMDQDTPKIADFGLARSSRLKPVTQSMDVKGSPHYMSPEHFFDFKR
FT                   ADQCADVYSLGKMLFEAVEGKITSVTTPFKRAKLAKAESPFFQELDRIIQMATAESRDE
FT                   RTESVRDLLGQLERVIHGLASQKPGAKFPWQQSASLFSKPRWVWTGIIVAVLSVISMAA
FT                   WHFMGEPGLGPPKGSLSTSPSQHQTQTVPGNETTARPADAEKDSFASEHLGKQHLIQGG
FT                   PFSIPAVLDGSSDQSIQVEPFYVDEFFVTNQQFVDFLNHNLSQISIESGVVKGSGANWF
FT                   LMGEVRAGYEPIVYRSNEFHVSDPAYASSPALRVTGYGASAFANYFGRRLPTEVEMLFA
FT                   MVKGEDGSKVNAEPSAEVNTQPMGGMMRMMGDWQGETENWSSVSPDPSPSAKDQAEPKR
FT                   SDFLLSAASFSPNLLGIKGLNHEIGEWVYTEGLVQPSANASTTNRYAVIGGVEGAPKDK
FT                   NSLPAVVVRFPWEGFEEIGFRTVKSAVVSNSAG"
     MELKAHDMTT TCKTTLKVGD VLNNRWVILG FIDKGGMGEV YRAHQTNLNR DVAIKVVSRE        60
     WLESIDEGDE EAETLVQRFR REVQAMAQIR HPNILQVFDH DAITVKKGDQ DKSMEYIAME       120
     YIPGGSLRDT MSDEGFYPEE DLIKTWVRRY FLPVLAGVMA LHENGIVHRD LKPENIFMDQ       180
     DTPKIADFGL ARSSRLKPVT QSMDVKGSPH YMSPEHFFDF KRADQCADVY SLGKMLFEAV       240
     EGKITSVTTP FKRAKLAKAE SPFFQELDRI IQMATAESRD ERTESVRDLL GQLERVIHGL       300
     ASQKPGAKFP WQQSASLFSK PRWVWTGIIV AVLSVISMAA WHFMGEPGLG PPKGSLSTSP       360
     SQHQTQTVPG NETTARPADA EKDSFASEHL GKQHLIQGGP FSIPAVLDGS SDQSIQVEPF       420
     YVDEFFVTNQ QFVDFLNHNL SQISIESGVV KGSGANWFLM GEVRAGYEPI VYRSNEFHVS       480
     DPAYASSPAL RVTGYGASAF ANYFGRRLPT EVEMLFAMVK GEDGSKVNAE PSAEVNTQPM       540
     GGMMRMMGDW QGETENWSSV SPDPSPSAKD QAEPKRSDFL LSAASFSPNL LGIKGLNHEI       600
     GEWVYTEGLV QPSANASTTN RYAVIGGVEG APKDKNSLPA VVVRFPWEGF EEIGFRTVKS       660
     AVVSNSAG                                                                668
//

If you have problems or comments...

PBIL Back to PBIL home page