(data stored in ACNUC7421 zone)

EMBL: CP000859.PE424

CP000859.PE424       Location/Qualifiers
FT   CDS             complement(489253..489558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0424"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66234"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTH0"
FT                   /protein_id="ABW66234.1"
FT                   /translation="MELGEKRKDVEIKSERPDEKDPLTKYFDGMGTATARIIIKRHLDD
FT                   DQWEKYGLKDLKNTGRYYIARLVEKDGTVIDEVLIDKQSGTIQSLRGRIGAEGQLR"
     MELGEKRKDV EIKSERPDEK DPLTKYFDGM GTATARIIIK RHLDDDQWEK YGLKDLKNTG        60
     RYYIARLVEK DGTVIDEVLI DKQSGTIQSL RGRIGAEGQL R                           101
//

If you have problems or comments...

PBIL Back to PBIL home page