(data stored in ACNUC7421 zone)

EMBL: CP000859.PE429

CP000859.PE429       Location/Qualifiers
FT   CDS             494943..495416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0429"
FT                   /product="zinc-resistance associated protein"
FT                   /note="KEGG: stm:STM4172 zinc-resistance associated
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66239"
FT                   /db_xref="InterPro:IPR025961"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTH5"
FT                   /protein_id="ABW66239.1"
FT                   /translation="MKRNTKGIMTLAVLAVFGFSTLAFAGWGDGYGHMMGPGMMGPGWQ
FT                   QGSGYYGNLSADEIAKLEQQRAEFFRATENTRQQLYEKNLALQSELAKENPDTAKASKL
FT                   QGEISKLQSDLDQKRLEYDIQARKSAPNYNRGYRGGYGSMMGYGPRGGGYCGW"
     MKRNTKGIMT LAVLAVFGFS TLAFAGWGDG YGHMMGPGMM GPGWQQGSGY YGNLSADEIA        60
     KLEQQRAEFF RATENTRQQL YEKNLALQSE LAKENPDTAK ASKLQGEISK LQSDLDQKRL       120
     EYDIQARKSA PNYNRGYRGG YGSMMGYGPR GGGYCGW                                157
//

If you have problems or comments...

PBIL Back to PBIL home page