(data stored in ACNUC7421 zone)

EMBL: CP000859.PE43

CP000859.PE43        Location/Qualifiers
FT   CDS             51701..54091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0043"
FT                   /product="LVIVD repeat protein"
FT                   /note="PFAM: LVIVD repeat protein; KEGG: mma:MM_0391
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65853"
FT                   /db_xref="InterPro:IPR013211"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRT6"
FT                   /protein_id="ABW65853.1"
FT                   /translation="MKQRLSRWMITIFCCLWATGVHALVGDIQLLNRWPMAGPNSIAIA
FT                   DIDGTDYVFVGDGEVVSVYDTTPALLSRFDVALSGAADLDKPGEVAGTEGIYGIFYAEN
FT                   HLYVACGNEGLQIFDVTDPLNVGTPTGVYIPRETLGRAKVSDVTVLDGYAYLTYFLLTS
FT                   EGYDSGIQVIDVTNPANPVLKGESELPDTFADLKRAQGLHVTDIDGTLYAFVADLYNGL
FT                   AIFDVNVPADPHAEASCYFTYAYDVTVAEIPADSGNYYAYVADDFAGLRIISFDPDEFT
FT                   NEVDILYGAEGNVIPTCQYAGGSSKALSVTVDPANELVFVGDQYYGLLAIDVSDVAKIN
FT                   TLPGDVDLTGYVTNYATDMTSAYSVCAETGGPTVVYVADAIKGFQRASLVDPMDETTWE
FT                   ITGVENTNTPADADALFIDENTNYIYVVDDDATNAGHDEGLRIFYAIVSEEYLTFLLKG
FT                   KLPTDGEAKDVYVHDGYVYVADGSKGLKIIDPGLPEDGDDADEDGDNQFVAQPELTGSC
FT                   VVAGGTGDAMDVVVSGTFAYVAAGAGGLSIINVVNKTAPQEKGVLGGAHISDARAVWVK
FT                   DVDGNGTDDYAYVADGGNGLKIVDISDKTNPALVKTVALEGTAQSVFELRGRAYVAGGD
FT                   AGFHVVFVSDLENARLVSGYNAAPFEDVKDVFAAISNESPAVDLLWVATGKTGMGFFTY
FT                   PPDVPPQLVVHFDTFGDAKAVSVFGDFAFLADGAGGLLATTVSTASGGATDEGWDWLAG
FT                   IVPVDIHSTTYGGSSGCAVDTVRPAATGLWQSLKKLFHKGSAF"
     MKQRLSRWMI TIFCCLWATG VHALVGDIQL LNRWPMAGPN SIAIADIDGT DYVFVGDGEV        60
     VSVYDTTPAL LSRFDVALSG AADLDKPGEV AGTEGIYGIF YAENHLYVAC GNEGLQIFDV       120
     TDPLNVGTPT GVYIPRETLG RAKVSDVTVL DGYAYLTYFL LTSEGYDSGI QVIDVTNPAN       180
     PVLKGESELP DTFADLKRAQ GLHVTDIDGT LYAFVADLYN GLAIFDVNVP ADPHAEASCY       240
     FTYAYDVTVA EIPADSGNYY AYVADDFAGL RIISFDPDEF TNEVDILYGA EGNVIPTCQY       300
     AGGSSKALSV TVDPANELVF VGDQYYGLLA IDVSDVAKIN TLPGDVDLTG YVTNYATDMT       360
     SAYSVCAETG GPTVVYVADA IKGFQRASLV DPMDETTWEI TGVENTNTPA DADALFIDEN       420
     TNYIYVVDDD ATNAGHDEGL RIFYAIVSEE YLTFLLKGKL PTDGEAKDVY VHDGYVYVAD       480
     GSKGLKIIDP GLPEDGDDAD EDGDNQFVAQ PELTGSCVVA GGTGDAMDVV VSGTFAYVAA       540
     GAGGLSIINV VNKTAPQEKG VLGGAHISDA RAVWVKDVDG NGTDDYAYVA DGGNGLKIVD       600
     ISDKTNPALV KTVALEGTAQ SVFELRGRAY VAGGDAGFHV VFVSDLENAR LVSGYNAAPF       660
     EDVKDVFAAI SNESPAVDLL WVATGKTGMG FFTYPPDVPP QLVVHFDTFG DAKAVSVFGD       720
     FAFLADGAGG LLATTVSTAS GGATDEGWDW LAGIVPVDIH STTYGGSSGC AVDTVRPAAT       780
     GLWQSLKKLF HKGSAF                                                       796
//

If you have problems or comments...

PBIL Back to PBIL home page