(data stored in ACNUC7421 zone)

EMBL: CP000859.PE432

CP000859.PE432       Location/Qualifiers
FT   CDS             complement(498097..499956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0432"
FT                   /product="type III restriction protein res subunit"
FT                   /note="PFAM: helicase domain protein; type III restriction
FT                   protein res subunit; SMART: DEAD-like helicases; KEGG:
FT                   pap:PSPA7_3695 putative helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66242"
FT                   /db_xref="GOA:A8ZTH8"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTH8"
FT                   /protein_id="ABW66242.1"
FT                   /translation="MTNEEIARFFNDTQAYIQGNADLRDPQVEGWFRTRQHFRNSSEHA
FT                   ILQIPVGCGKTGLMALLPFGIAQGRVLVIAPNLEIRRGISTAFDIAGRDCFWTYTRVLT
FT                   DVNHGPYTAVLDGQDANIHDCENSHIVVTNIQQLASRADRWLPAFPDDFFDLIMVDEGH
FT                   HNVARSWERVFERFPNAKVVSLTATPFRGDGREIAGEVVYAYPFRTAMVRGYIKQITAV
FT                   NVAPQEISFTYRGDSRHHTLDEVLQLRDEEWFSRGVALAPECNRSIVDASIQWLQHLRE
FT                   SGTFHQLIAVACSVDHSRQVRSLYAERGLNAREIHSNMPADQIEEVLQDLRRSRIDCIV
FT                   QVRMLGEGFDHPNLSVAAIFQPFRSLSPYVQFIGRVMRVIHQNNPQHPDNRGIAVSHVG
FT                   LNIDRHWDDFRRIDREDQELIQGWLESGDERPPADEPGRRRRLTPDMVVQDEIISHFIE
FT                   QAYLDPMDDAVIDDLVEEFRRRGLDPEALGLSRDNLRQRLIQARTRESMEPREIPVTPQ
FT                   RRRQEARRRLNERSRALASRIVSAIGASINGRNIALTYPELRSVNNYAAVVQIVNRAVN
FT                   ERLEADVGTRGEIPLERLEEVLEQIDQIGDEVQADIQERLSRR"
     MTNEEIARFF NDTQAYIQGN ADLRDPQVEG WFRTRQHFRN SSEHAILQIP VGCGKTGLMA        60
     LLPFGIAQGR VLVIAPNLEI RRGISTAFDI AGRDCFWTYT RVLTDVNHGP YTAVLDGQDA       120
     NIHDCENSHI VVTNIQQLAS RADRWLPAFP DDFFDLIMVD EGHHNVARSW ERVFERFPNA       180
     KVVSLTATPF RGDGREIAGE VVYAYPFRTA MVRGYIKQIT AVNVAPQEIS FTYRGDSRHH       240
     TLDEVLQLRD EEWFSRGVAL APECNRSIVD ASIQWLQHLR ESGTFHQLIA VACSVDHSRQ       300
     VRSLYAERGL NAREIHSNMP ADQIEEVLQD LRRSRIDCIV QVRMLGEGFD HPNLSVAAIF       360
     QPFRSLSPYV QFIGRVMRVI HQNNPQHPDN RGIAVSHVGL NIDRHWDDFR RIDREDQELI       420
     QGWLESGDER PPADEPGRRR RLTPDMVVQD EIISHFIEQA YLDPMDDAVI DDLVEEFRRR       480
     GLDPEALGLS RDNLRQRLIQ ARTRESMEPR EIPVTPQRRR QEARRRLNER SRALASRIVS       540
     AIGASINGRN IALTYPELRS VNNYAAVVQI VNRAVNERLE ADVGTRGEIP LERLEEVLEQ       600
     IDQIGDEVQA DIQERLSRR                                                    619
//

If you have problems or comments...

PBIL Back to PBIL home page