(data stored in ACNUC7421 zone)

EMBL: CP000859.PE435

CP000859.PE435       Location/Qualifiers
FT   CDS             502435..503460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0435"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sfu:Sfum_3781 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66245"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTI1"
FT                   /protein_id="ABW66245.1"
FT                   /translation="MGIAPLVEWQQHLDGWPGFSVFRKRHLQLTKSQATAVECRTDCGL
FT                   GCPRNVVTHAPNDIVAVCPEQEEKPYPLKQQDTLIYSVKRASLHKDICSALGITHRESK
FT                   VDGCRRTWRLGDFVPTAGLVFPVFLTQQENQDELLEIVKNLCLLHADPFVLLTPTRRRL
FT                   SPPVEQMLAQRKAVFLALEEEMPFDEQSDLQVRRTPDELFAAFHEDVPEPGSGGMVHFP
FT                   TPDGIRWSDIKIQFRNGHTVTIWAGGQSGRYTYYQMGMYSKKNGDRTVQWKLLEAFAAS
FT                   RGEIDWSNQAANNKLKKQKQELSKCLREFFRLQEDPIEWVKGEKCYRCRFRILPEGDEN
FT                   Y"
     MGIAPLVEWQ QHLDGWPGFS VFRKRHLQLT KSQATAVECR TDCGLGCPRN VVTHAPNDIV        60
     AVCPEQEEKP YPLKQQDTLI YSVKRASLHK DICSALGITH RESKVDGCRR TWRLGDFVPT       120
     AGLVFPVFLT QQENQDELLE IVKNLCLLHA DPFVLLTPTR RRLSPPVEQM LAQRKAVFLA       180
     LEEEMPFDEQ SDLQVRRTPD ELFAAFHEDV PEPGSGGMVH FPTPDGIRWS DIKIQFRNGH       240
     TVTIWAGGQS GRYTYYQMGM YSKKNGDRTV QWKLLEAFAA SRGEIDWSNQ AANNKLKKQK       300
     QELSKCLREF FRLQEDPIEW VKGEKCYRCR FRILPEGDEN Y                           341
//

If you have problems or comments...

PBIL Back to PBIL home page