(data stored in ACNUC7421 zone)

EMBL: CP000859.PE438

CP000859.PE438       Location/Qualifiers
FT   CDS             complement(505956..506567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0438"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dvl:Dvul_0722 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66248"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTI4"
FT                   /protein_id="ABW66248.1"
FT                   /translation="MSESDKLQPFFDRLADLYARMDAAYNATAGRYGFDCADCADNCCY
FT                   TVFYNHTSIEYFYLMEGLARLSEEKRRAVVAKALDARNQVDAAKAAGQKPRVLCPLNEN
FT                   GLCAMHGHRLMICRLHGIPYEIHYPGRTPFKGSGCEVFETRCTGTAYLPFDRTPFYSEL
FT                   AQLEQAVRQATGRNEKVKMTIAQMLSTDLPADLSHAGGAR"
     MSESDKLQPF FDRLADLYAR MDAAYNATAG RYGFDCADCA DNCCYTVFYN HTSIEYFYLM        60
     EGLARLSEEK RRAVVAKALD ARNQVDAAKA AGQKPRVLCP LNENGLCAMH GHRLMICRLH       120
     GIPYEIHYPG RTPFKGSGCE VFETRCTGTA YLPFDRTPFY SELAQLEQAV RQATGRNEKV       180
     KMTIAQMLST DLPADLSHAG GAR                                               203
//

If you have problems or comments...

PBIL Back to PBIL home page