(data stored in ACNUC7421 zone)

EMBL: CP000859.PE442

CP000859.PE442       Location/Qualifiers
FT   CDS             511044..511238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0442"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: noc:Noc_0412 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66252"
FT                   /db_xref="GOA:A8ZTI8"
FT                   /db_xref="InterPro:IPR012933"
FT                   /db_xref="InterPro:IPR038570"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTI8"
FT                   /protein_id="ABW66252.1"
FT                   /translation="MPRKIRQLIKDLENAGFVNRGGKGSHRNFLHEKGIAVTISGQPGD
FT                   DVKPYQEKIVKQKIEEAKS"
     MPRKIRQLIK DLENAGFVNR GGKGSHRNFL HEKGIAVTIS GQPGDDVKPY QEKIVKQKIE        60
     EAKS                                                                     64
//

If you have problems or comments...

PBIL Back to PBIL home page