(data stored in ACNUC7421 zone)

EMBL: CP000859.PE446

CP000859.PE446       Location/Qualifiers
FT   CDS             513719..514300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0446"
FT                   /product="Cro-like protein"
FT                   /note="KEGG: acb:A1S_3464 Cro-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66256"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTJ2"
FT                   /protein_id="ABW66256.1"
FT                   /translation="MNKYLTSSAIIDWDNPKVMTKAKDLAQGVDSSLEIAKKCFIYVRD
FT                   EIQHSNDYQLNPVTCKASDVLEHKTGFCYAKSHLLAALLRANGIPAGLCYQRLAVENDK
FT                   PPFCLHGLNAVYLPDFGWYRIDARGNKEGVFTEFIPPVEKLAFQIVNEGEADFQEIWSD
FT                   PLPEIKKVLESSNSFQEVADNLPDIEIIKS"
     MNKYLTSSAI IDWDNPKVMT KAKDLAQGVD SSLEIAKKCF IYVRDEIQHS NDYQLNPVTC        60
     KASDVLEHKT GFCYAKSHLL AALLRANGIP AGLCYQRLAV ENDKPPFCLH GLNAVYLPDF       120
     GWYRIDARGN KEGVFTEFIP PVEKLAFQIV NEGEADFQEI WSDPLPEIKK VLESSNSFQE       180
     VADNLPDIEI IKS                                                          193
//

If you have problems or comments...

PBIL Back to PBIL home page