(data stored in ACNUC7421 zone)

EMBL: CP000859.PE447

CP000859.PE447       Location/Qualifiers
FT   CDS             514385..514981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0447"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66257"
FT                   /db_xref="GOA:A8ZTJ3"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTJ3"
FT                   /protein_id="ABW66257.1"
FT                   /translation="MEALAAIGFGRSGGAGRRRNVRDERIRRYLKMKLSQALIIILLVA
FT                   NLIATIWFGINKEPGGEVSQIAKAAHHELPPVVSSEVRNEIFETFFQYFNAADYDSLYN
FT                   MFGPVAKAEVLKEASVKEFKRMVDYFHSIESGVYIYSELLGSRGNTNIYTMYYSVNLSE
FT                   KSEFGTKGTLKVTIAVQGNEYQIYGIRLNAESAAQ"
     MEALAAIGFG RSGGAGRRRN VRDERIRRYL KMKLSQALII ILLVANLIAT IWFGINKEPG        60
     GEVSQIAKAA HHELPPVVSS EVRNEIFETF FQYFNAADYD SLYNMFGPVA KAEVLKEASV       120
     KEFKRMVDYF HSIESGVYIY SELLGSRGNT NIYTMYYSVN LSEKSEFGTK GTLKVTIAVQ       180
     GNEYQIYGIR LNAESAAQ                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page