(data stored in ACNUC7421 zone)

EMBL: CP000859.PE449

CP000859.PE449       Location/Qualifiers
FT   CDS             517312..517833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0449"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sfu:Sfum_1145 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66259"
FT                   /db_xref="InterPro:IPR025751"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTJ5"
FT                   /protein_id="ABW66259.1"
FT                   /translation="MTGLDKRIAGKKKEILGAWFERVSETYQDQTRSFLNKGGDRFANP
FT                   VAGIVSESLEKTLEGLLSGAGIEVLSQCMDPLIRVRAVQGLSPSASLAFVFSLKSILRD
FT                   LLHIQGPEADQMALMDKRIDGLALICFDKFMECREKIYELKACEVRNRTFKAFERAGLI
FT                   VDPEAAEPRA"
     MTGLDKRIAG KKKEILGAWF ERVSETYQDQ TRSFLNKGGD RFANPVAGIV SESLEKTLEG        60
     LLSGAGIEVL SQCMDPLIRV RAVQGLSPSA SLAFVFSLKS ILRDLLHIQG PEADQMALMD       120
     KRIDGLALIC FDKFMECREK IYELKACEVR NRTFKAFERA GLIVDPEAAE PRA              173
//

If you have problems or comments...

PBIL Back to PBIL home page