(data stored in ACNUC7421 zone)

EMBL: CP000859.PE450

CP000859.PE450       Location/Qualifiers
FT   CDS             517894..518922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0450"
FT                   /product="Nitrate reductase gamma subunit"
FT                   /note="PFAM: Nitrate reductase gamma subunit; KEGG:
FT                   sfu:Sfum_1146 nitrate reductase, gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66260"
FT                   /db_xref="GOA:A8ZTJ6"
FT                   /db_xref="InterPro:IPR023234"
FT                   /db_xref="InterPro:IPR036197"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTJ6"
FT                   /protein_id="ABW66260.1"
FT                   /translation="MNVSYLFAFVAVVVLILLAWAGVGAWGMTGVFGILVPYAAMLLFV
FT                   VGFARKILDWSNSYVPFRIPTTCGQQKSLPWIRQNKIDNPNTTGGVIVRMLLEILLFRS
FT                   LFRNTRAKFKDNNRLSYRWEIVLWVAALAFHYAFAVTLLRHMRFFFEPVPMVIQLLESA
FT                   DAFFRVEFFSPYFVIGLPGVYASGLVLLGALLLLLGRRIFLSQVRYVSLAADFFPLFLI
FT                   IGIAASGILMRYFAKVDISAIKTFAMGLATFKPVPPDGVSALFYVHLFLVSVLAAYFPF
FT                   SKLMHAGGVFLSPTRNMANNNRAVRHVNPWNYSVHTHTYDEYEDEFREKMIEAGLPVEK
FT                   EQ"
     MNVSYLFAFV AVVVLILLAW AGVGAWGMTG VFGILVPYAA MLLFVVGFAR KILDWSNSYV        60
     PFRIPTTCGQ QKSLPWIRQN KIDNPNTTGG VIVRMLLEIL LFRSLFRNTR AKFKDNNRLS       120
     YRWEIVLWVA ALAFHYAFAV TLLRHMRFFF EPVPMVIQLL ESADAFFRVE FFSPYFVIGL       180
     PGVYASGLVL LGALLLLLGR RIFLSQVRYV SLAADFFPLF LIIGIAASGI LMRYFAKVDI       240
     SAIKTFAMGL ATFKPVPPDG VSALFYVHLF LVSVLAAYFP FSKLMHAGGV FLSPTRNMAN       300
     NNRAVRHVNP WNYSVHTHTY DEYEDEFREK MIEAGLPVEK EQ                          342
//

If you have problems or comments...

PBIL Back to PBIL home page