(data stored in ACNUC7421 zone)

EMBL: CP000859.PE453

CP000859.PE453       Location/Qualifiers
FT   CDS             520951..521784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0453"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: dvl:Dvul_1778 4Fe-4S ferredoxin, iron-sulfur
FT                   binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66263"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTJ9"
FT                   /protein_id="ABW66263.1"
FT                   /translation="MESNRRAFLKIAGITAAGITVAPVLTRFTASAEDTAQKGGAPSGK
FT                   TMSGTEALTARHWGMVIDTRQFTSAADLDPLIEACHKVHNVPTFETDLETPFFSADKNR
FT                   HEIKWLWEDEFKHVFPDAENKYLAQRLAELPFLALCNHCENPPCVRACPTKATFQREDG
FT                   IVMMDFHRCIGCRFCMAACPYGSRSFNFRDPREGLKETNIAFPTRMKGVVEKCNFCAER
FT                   LAKGQLPACVEASNGAILFGDLDDPASEVRRALEENFTIRRKPSLGTEPSVYYIV"
     MESNRRAFLK IAGITAAGIT VAPVLTRFTA SAEDTAQKGG APSGKTMSGT EALTARHWGM        60
     VIDTRQFTSA ADLDPLIEAC HKVHNVPTFE TDLETPFFSA DKNRHEIKWL WEDEFKHVFP       120
     DAENKYLAQR LAELPFLALC NHCENPPCVR ACPTKATFQR EDGIVMMDFH RCIGCRFCMA       180
     ACPYGSRSFN FRDPREGLKE TNIAFPTRMK GVVEKCNFCA ERLAKGQLPA CVEASNGAIL       240
     FGDLDDPASE VRRALEENFT IRRKPSLGTE PSVYYIV                                277
//

If you have problems or comments...

PBIL Back to PBIL home page