(data stored in ACNUC7421 zone)

EMBL: CP000859.PE456

CP000859.PE456       Location/Qualifiers
FT   CDS             complement(523994..525079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0456"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: chy:CHY_0095 iron-sulfur cluster-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66266"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTK2"
FT                   /protein_id="ABW66266.1"
FT                   /translation="MSDQTYRTAASAVIAAGAIPFPVNDTLLEILKNIMTPEQAGFVQL
FT                   LDRPLNREEIKKKSGMADADLDQMLNSLMKSGVISGTASRGSGLMVYRAMPPIPGIFET
FT                   TMMRGETGEKQKTLARLFENLFEELAGMVQANYDAIVPAFKAMPPMTRIVPVEKHIDRA
FT                   FDTVMPCEDVKKLVDRFDTIGVATCYCRHQKDLLDRPCKVTDERKNCLFFGKTAEFFIT
FT                   YGFAEPITQDQAKQILEKAEADGLVHKAFHEKYDTGRNEMAICNCCKCCCETFQSYYRG
FT                   SSPTITYAAYVARVDADTCTGCEACADICPMEAIEMKDDIAHVSDSRCIGCGVCAYHCP
FT                   ADALALERTGQREVFVPPPKH"
     MSDQTYRTAA SAVIAAGAIP FPVNDTLLEI LKNIMTPEQA GFVQLLDRPL NREEIKKKSG        60
     MADADLDQML NSLMKSGVIS GTASRGSGLM VYRAMPPIPG IFETTMMRGE TGEKQKTLAR       120
     LFENLFEELA GMVQANYDAI VPAFKAMPPM TRIVPVEKHI DRAFDTVMPC EDVKKLVDRF       180
     DTIGVATCYC RHQKDLLDRP CKVTDERKNC LFFGKTAEFF ITYGFAEPIT QDQAKQILEK       240
     AEADGLVHKA FHEKYDTGRN EMAICNCCKC CCETFQSYYR GSSPTITYAA YVARVDADTC       300
     TGCEACADIC PMEAIEMKDD IAHVSDSRCI GCGVCAYHCP ADALALERTG QREVFVPPPK       360
     H                                                                       361
//

If you have problems or comments...

PBIL Back to PBIL home page