(data stored in ACNUC7421 zone)

EMBL: CP000859.PE457

CP000859.PE457       Location/Qualifiers
FT   CDS             complement(525097..525717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0457"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: hch:HCH_05785
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66267"
FT                   /db_xref="GOA:A8ZTK3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTK3"
FT                   /protein_id="ABW66267.1"
FT                   /translation="MKKPNTIHAASCGRQRQIIEAALACFTEKGFPATSIADICKKAGA
FT                   STGSVYHHFKSKGRLAAAIYLEGVRDYQAGMIDALSKETTAKGGIFAIVQYHLTWVKTH
FT                   PEWARFLFQKRHAEYMDDTEDRMKQLNAEFVKQMSAWFAKHMESGAIRPLPRDVFSALL
FT                   LGPCQEFARMHVTGYAKTDVTEAARHLAAAAWASLGNFTINPS"
     MKKPNTIHAA SCGRQRQIIE AALACFTEKG FPATSIADIC KKAGASTGSV YHHFKSKGRL        60
     AAAIYLEGVR DYQAGMIDAL SKETTAKGGI FAIVQYHLTW VKTHPEWARF LFQKRHAEYM       120
     DDTEDRMKQL NAEFVKQMSA WFAKHMESGA IRPLPRDVFS ALLLGPCQEF ARMHVTGYAK       180
     TDVTEAARHL AAAAWASLGN FTINPS                                            206
//

If you have problems or comments...

PBIL Back to PBIL home page