(data stored in ACNUC7421 zone)

EMBL: CP000859.PE464

CP000859.PE464       Location/Qualifiers
FT   CDS             529984..530436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0464"
FT                   /product="putative transcriptional regulator, AsnC family"
FT                   /note="SMART: regulatory protein AsnC/Lrp family; KEGG:
FT                   mta:Moth_2198 putative transcriptional regulator, AsnC
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66274"
FT                   /db_xref="GOA:A8ZTL0"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR040523"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTL0"
FT                   /protein_id="ABW66274.1"
FT                   /translation="MHLDDTDRAILNAVQSDFPLAPRPFSAIGEQLGLDEDEVVRRMAR
FT                   LKREGIIRRIGGNFVPEKLGYVSTLCAASVPEDRIETFALAVNEYPGVTHNYIRDNTYN
FT                   VWFTFIAPSRDAIEESLAEIAKKTGVTRIINLPATRVFKIRAAFNL"
     MHLDDTDRAI LNAVQSDFPL APRPFSAIGE QLGLDEDEVV RRMARLKREG IIRRIGGNFV        60
     PEKLGYVSTL CAASVPEDRI ETFALAVNEY PGVTHNYIRD NTYNVWFTFI APSRDAIEES       120
     LAEIAKKTGV TRIINLPATR VFKIRAAFNL                                        150
//

If you have problems or comments...

PBIL Back to PBIL home page