(data stored in ACNUC7421 zone)

EMBL: CP000859.PE470

CP000859.PE470       Location/Qualifiers
FT   CDS             535141..536385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0470"
FT                   /product="transcription termination factor Rho"
FT                   /note="KEGG: sfu:Sfum_1711 transcription termination factor
FT                   Rho; TIGRFAM: transcription termination factor Rho; PFAM:
FT                   H+transporting two-sector ATPase alpha/beta subunit central
FT                   region; Rho termination factor domain protein; Rho
FT                   termination factor RNA-binding; Ribonuclease B OB region
FT                   domain; SMART: AAA ATPase; Cold shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66280"
FT                   /db_xref="GOA:A8ZTL6"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="InterPro:IPR041703"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTL6"
FT                   /protein_id="ABW66280.1"
FT                   /translation="MDISELKKKKMDELKEIAAGYEVDSAGMKKQELIFSILQAEAENN
FT                   GYIFGESTLEVLSDGFGFLRSPDSSYLPGLDDIYVSPSQIRRFNLRTGDIVSGQIRQPK
FT                   ENERYFALLKVEAINHEDPEIARHKTPFDNLTPLFPNEKIKLERESDNYSMRIMDLLTP
FT                   IGFGQRGLIVSPPRAGKTMLLQNIANSIIASHKKVVPFVLLIDERPEEVTDMKRSVNAE
FT                   VISSTFDEPADRHVQVAEMVIEKARRLVEHKKDVVILLDSITRLARAYNSVVPSSGKVL
FT                   SGGVDSNALHRPKRFFGAARNIEEGGSLTIMATALIDTGSRMDDVIFEEFKGTGNMELH
FT                   LDRKLADRRVYPAIDINRSGTRKEELLVEKDVLNRVWVLRKLLATLNSVDGMEFLLDKM
FT                   SSTKSNKDFMDAMNS"
     MDISELKKKK MDELKEIAAG YEVDSAGMKK QELIFSILQA EAENNGYIFG ESTLEVLSDG        60
     FGFLRSPDSS YLPGLDDIYV SPSQIRRFNL RTGDIVSGQI RQPKENERYF ALLKVEAINH       120
     EDPEIARHKT PFDNLTPLFP NEKIKLERES DNYSMRIMDL LTPIGFGQRG LIVSPPRAGK       180
     TMLLQNIANS IIASHKKVVP FVLLIDERPE EVTDMKRSVN AEVISSTFDE PADRHVQVAE       240
     MVIEKARRLV EHKKDVVILL DSITRLARAY NSVVPSSGKV LSGGVDSNAL HRPKRFFGAA       300
     RNIEEGGSLT IMATALIDTG SRMDDVIFEE FKGTGNMELH LDRKLADRRV YPAIDINRSG       360
     TRKEELLVEK DVLNRVWVLR KLLATLNSVD GMEFLLDKMS STKSNKDFMD AMNS             414
//

If you have problems or comments...

PBIL Back to PBIL home page