(data stored in ACNUC7421 zone)

EMBL: CP000859.PE472

CP000859.PE472       Location/Qualifiers
FT   CDS             536892..537962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0472"
FT                   /product="peptide chain release factor 1"
FT                   /note="TIGRFAM: peptide chain release factor 1; PFAM: Class
FT                   I peptide chain release factor; PCRF domain protein; KEGG:
FT                   pca:Pcar_2692 peptide chain release factor 1"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66282"
FT                   /db_xref="GOA:A8ZTL8"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004373"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ZTL8"
FT                   /protein_id="ABW66282.1"
FT                   /translation="MFDRLQDVERRFGELEGLMADPSIVNDREAYQKHSREHAELADIV
FT                   DAYRRYKAVSDEIEKSRDLLEDRDPEIRELAKEEISRLKDERERLDGELQNLLTPKDPN
FT                   DNKNVLVEIRAGTGGEEASLFAHDLFRMYWRYAETMGWKTEIMSSSVTGSGGFKEVIFM
FT                   VYGKGAYSHLKFESGIHRVQRVPETEAQGRIHTSAVTVAVLAEAEEVELHIDPSEIKTD
FT                   VFRSSGPGGQSVNTTDSAVRLTHLPTGVVVICQDEKSQLKNKNKAMKVLRARLLDRMIQ
FT                   DQNEKIAQNRKDQVGSGDRSGRIRTYNFPQGRVTDHRAGITLYKLESVLQGDLSELVNG
FT                   LATYFQAERLKQADAS"
     MFDRLQDVER RFGELEGLMA DPSIVNDREA YQKHSREHAE LADIVDAYRR YKAVSDEIEK        60
     SRDLLEDRDP EIRELAKEEI SRLKDERERL DGELQNLLTP KDPNDNKNVL VEIRAGTGGE       120
     EASLFAHDLF RMYWRYAETM GWKTEIMSSS VTGSGGFKEV IFMVYGKGAY SHLKFESGIH       180
     RVQRVPETEA QGRIHTSAVT VAVLAEAEEV ELHIDPSEIK TDVFRSSGPG GQSVNTTDSA       240
     VRLTHLPTGV VVICQDEKSQ LKNKNKAMKV LRARLLDRMI QDQNEKIAQN RKDQVGSGDR       300
     SGRIRTYNFP QGRVTDHRAG ITLYKLESVL QGDLSELVNG LATYFQAERL KQADAS           356
//

If you have problems or comments...

PBIL Back to PBIL home page