(data stored in ACNUC7421 zone)

EMBL: CP000859.PE48

CP000859.PE48        Location/Qualifiers
FT   CDS             57271..58482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0048"
FT                   /product="conserved hypothetical cytosolic protein"
FT                   /note="KEGG: sat:SYN_02573 hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65858"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRU1"
FT                   /protein_id="ABW65858.1"
FT                   /translation="MFIDFFYKLKDIGVPVTPTAFLTLHRALALNLVNSVDDFYTTSRT
FT                   ILVKSERYFDLFDQLFAHYFQGADMPDPDDWEIDEIMRAMLDEWLKDPKELADMLGITP
FT                   EALAQMTPDQVVEYFKERLKDQTERHDGGNRWIGTRGTSPVGHSGTHPGGMRVGGVSRN
FT                   KSAVKVAMERRYKDYSRSGPLTQAQVGEALKRLRNMVPSGPKDQVNIDKSIYHTVKNGG
FT                   EIEIIFDRSLKDRLKVILAIDNGGWSMDPYVEVVQTLFDYAKAQFKEVKTFFFHNTVYD
FT                   ALWKDPTRYKEPQWVSELARRDPDTRVILVGDASMAPYELMAADGAIYLDRRGAYGLKK
FT                   ARRSSIDNLRFIADTFSHAIWLNPVPERMWDYTQTISMIRQVFPMFELSLDGLEQAVTH
FT                   LMAQ"
     MFIDFFYKLK DIGVPVTPTA FLTLHRALAL NLVNSVDDFY TTSRTILVKS ERYFDLFDQL        60
     FAHYFQGADM PDPDDWEIDE IMRAMLDEWL KDPKELADML GITPEALAQM TPDQVVEYFK       120
     ERLKDQTERH DGGNRWIGTR GTSPVGHSGT HPGGMRVGGV SRNKSAVKVA MERRYKDYSR       180
     SGPLTQAQVG EALKRLRNMV PSGPKDQVNI DKSIYHTVKN GGEIEIIFDR SLKDRLKVIL       240
     AIDNGGWSMD PYVEVVQTLF DYAKAQFKEV KTFFFHNTVY DALWKDPTRY KEPQWVSELA       300
     RRDPDTRVIL VGDASMAPYE LMAADGAIYL DRRGAYGLKK ARRSSIDNLR FIADTFSHAI       360
     WLNPVPERMW DYTQTISMIR QVFPMFELSL DGLEQAVTHL MAQ                         403
//

If you have problems or comments...

PBIL Back to PBIL home page