(data stored in ACNUC7421 zone)

EMBL: CP000859.PE482

CP000859.PE482       Location/Qualifiers
FT   CDS             545871..548867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0482"
FT                   /product="Phosphoribosylformylglycinamidine synthase"
FT                   /EC_number="6.3.5.3"
FT                   /note="PFAM: AIR synthase related protein; AIR synthase
FT                   related protein domain protein; KEGG: sfu:Sfum_0432
FT                   phosphoribosylformylglycinamidine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66292"
FT                   /db_xref="GOA:A8ZTM8"
FT                   /db_xref="InterPro:IPR003850"
FT                   /db_xref="InterPro:IPR010074"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036604"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTM8"
FT                   /protein_id="ABW66292.1"
FT                   /translation="MAHRLEIALKPGLTDAQGQKVKKRAADYLSISLSDVRVVHVITLD
FT                   AALSEPQQWAVQEIFTNPVTQVSSFGPLAVAFDWIIWVGLRPGVKDNAGDTAKEAISDS
FT                   LGRTFTDDEGVYTSRRYCLTGDGLSREQVETIARELLANDTIEQWRLFSKEEWDDTSGI
FT                   GLIIPRVRLAHSPTVTLIPVESDAALMKVSDERNLALNPNDVPVIREYFVRKEVRERRR
FT                   AVGLSDPTDIEVEYISQARSDHCNHNTFGGRFYYKDLITGETLKIDSLFATCIRQPTLD
FT                   LQKEKPWVVSVLWDNAGMARFDEDHCYVITGETHNSPSNMEAYGGAMTGIVGVYRDPMG
FT                   TGKGARLVMGGYGFCTGRRDYDGDLKPRLSPRRLLDGVIEGVKDGGNKSGIPTTFGQLY
FT                   FDDGYMGKCLVFVTAIGILPAYINGEPSDKKTTRPDDLIVMCGGRVGKDGIHGVTASSE
FT                   VYSEHTPAGHVQIGDPYTQKKMHDFLLCARDAGLIQFITDNGGGGLSSSVGESALYSGG
FT                   CEVWLEKVPLKYAGLDQWEIWVSESQERMTVAVAPENIDRFLALSADHAVESTVIGKYT
FT                   DSGMLHILYDGATCAYIDLDFMASDFPQWEFEAHWTPPEARGLCEPVLGGSPDFNTLLS
FT                   DMLARPNICSREWVARQYDHEVQGGSAVKPLVGADRDIASDAAVTRPVLASEKGIAFAQ
FT                   ALLPAYSKIDAYHMTTAVIDEAVRRLVAVGADPAGIGGVDNFCWPNIAYNPASNPDGRF
FT                   KAAQLVRSCLALRDACNAFGIPLLSGKDSMYVDGHLAGRYGETRKVSALPTMQFSATAV
FT                   VDDVTACTTLEAKAEGDLVYVAGITRNELGASEYYELLGFTGLTIPRVRFDESSAVCRA
FT                   VATAIGRGLCASVHGVYRGGLGVHLAFVAMGGNLGMTVDLSKIVQEPGLSDHALLFSES
FT                   PARFVITVAPENRAAFEALWQDAPCACIGTVTGKNGRLTLSGQNGKPLVDREGATLKQT
FT                   WKQPFGNLI"
     MAHRLEIALK PGLTDAQGQK VKKRAADYLS ISLSDVRVVH VITLDAALSE PQQWAVQEIF        60
     TNPVTQVSSF GPLAVAFDWI IWVGLRPGVK DNAGDTAKEA ISDSLGRTFT DDEGVYTSRR       120
     YCLTGDGLSR EQVETIAREL LANDTIEQWR LFSKEEWDDT SGIGLIIPRV RLAHSPTVTL       180
     IPVESDAALM KVSDERNLAL NPNDVPVIRE YFVRKEVRER RRAVGLSDPT DIEVEYISQA       240
     RSDHCNHNTF GGRFYYKDLI TGETLKIDSL FATCIRQPTL DLQKEKPWVV SVLWDNAGMA       300
     RFDEDHCYVI TGETHNSPSN MEAYGGAMTG IVGVYRDPMG TGKGARLVMG GYGFCTGRRD       360
     YDGDLKPRLS PRRLLDGVIE GVKDGGNKSG IPTTFGQLYF DDGYMGKCLV FVTAIGILPA       420
     YINGEPSDKK TTRPDDLIVM CGGRVGKDGI HGVTASSEVY SEHTPAGHVQ IGDPYTQKKM       480
     HDFLLCARDA GLIQFITDNG GGGLSSSVGE SALYSGGCEV WLEKVPLKYA GLDQWEIWVS       540
     ESQERMTVAV APENIDRFLA LSADHAVEST VIGKYTDSGM LHILYDGATC AYIDLDFMAS       600
     DFPQWEFEAH WTPPEARGLC EPVLGGSPDF NTLLSDMLAR PNICSREWVA RQYDHEVQGG       660
     SAVKPLVGAD RDIASDAAVT RPVLASEKGI AFAQALLPAY SKIDAYHMTT AVIDEAVRRL       720
     VAVGADPAGI GGVDNFCWPN IAYNPASNPD GRFKAAQLVR SCLALRDACN AFGIPLLSGK       780
     DSMYVDGHLA GRYGETRKVS ALPTMQFSAT AVVDDVTACT TLEAKAEGDL VYVAGITRNE       840
     LGASEYYELL GFTGLTIPRV RFDESSAVCR AVATAIGRGL CASVHGVYRG GLGVHLAFVA       900
     MGGNLGMTVD LSKIVQEPGL SDHALLFSES PARFVITVAP ENRAAFEALW QDAPCACIGT       960
     VTGKNGRLTL SGQNGKPLVD REGATLKQTW KQPFGNLI                               998
//

If you have problems or comments...

PBIL Back to PBIL home page