(data stored in ACNUC7421 zone)

EMBL: CP000859.PE488

CP000859.PE488       Location/Qualifiers
FT   CDS             553377..553862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0488"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sfu:Sfum_2554 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66298"
FT                   /db_xref="GOA:A8ZTN4"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTN4"
FT                   /protein_id="ABW66298.1"
FT                   /translation="MNAKNSLAKRRANRSCSIGRNGFTLIEVLMAVAIFSIGVLGAASM
FT                   QTSAVSTTTRLRKATMGVACASDVMERLFSLDFSHPYLSAGTHAPGDGEDEDGDGEDDM
FT                   PVIPEYNSVFESITWRVDNQDLDVSTAGIDAKVITVTVLWGGGSRNITLTSARTFKA"
     MNAKNSLAKR RANRSCSIGR NGFTLIEVLM AVAIFSIGVL GAASMQTSAV STTTRLRKAT        60
     MGVACASDVM ERLFSLDFSH PYLSAGTHAP GDGEDEDGDG EDDMPVIPEY NSVFESITWR       120
     VDNQDLDVST AGIDAKVITV TVLWGGGSRN ITLTSARTFK A                           161
//

If you have problems or comments...

PBIL Back to PBIL home page