(data stored in ACNUC7421 zone)

EMBL: CP000859.PE494

CP000859.PE494       Location/Qualifiers
FT   CDS             complement(562038..562634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0494"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ttj:TTHA0837 metallo-beta-lactamase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66304"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTP0"
FT                   /protein_id="ABW66304.1"
FT                   /translation="MFFKQIILDGSGALSYFIGCPKARKACVVNPKKDIEEYMDTAAQF
FT                   GMQITDIIETAGFEARKSGAVELAGVTGASVWFLEAQEKTSGKVAKTGALFRFGDAEVK
FT                   VVRESRYTPFAKSLLVIDQAKPDKPWLVLTRRSLCADSRLNEAFAGKNMADELVDTIDF
FT                   YNTDTRDGITDNIASLARSLFHTSRADIARMSLPA"
     MFFKQIILDG SGALSYFIGC PKARKACVVN PKKDIEEYMD TAAQFGMQIT DIIETAGFEA        60
     RKSGAVELAG VTGASVWFLE AQEKTSGKVA KTGALFRFGD AEVKVVRESR YTPFAKSLLV       120
     IDQAKPDKPW LVLTRRSLCA DSRLNEAFAG KNMADELVDT IDFYNTDTRD GITDNIASLA       180
     RSLFHTSRAD IARMSLPA                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page