(data stored in ACNUC7421 zone)

EMBL: CP000859.PE497

CP000859.PE497       Location/Qualifiers
FT   CDS             complement(565127..565765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0497"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   sat:SYN_01560 queuosine biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66307"
FT                   /db_xref="GOA:A8ZTP3"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024924"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTP3"
FT                   /protein_id="ABW66307.1"
FT                   /translation="MSLHVSELFFSIQGESLDAGLACAFVRLAGCNLCCAYCDTAYARQ
FT                   GGTPMEIPEILDRVARFGCSLVEITGGEPLLQKETPLLIQRLLSVGYRVLLETNGTQNI
FT                   GLVDKSCIRIVDVKCPSSGESEKNDARNLDRLAAHDQVKFVISDRTDYLFAKKTAGRIT
FT                   AVAPGHILFSTVHGVLDPAQLAHWMLADGLPVRLHLQLHKILWGEARGK"
     MSLHVSELFF SIQGESLDAG LACAFVRLAG CNLCCAYCDT AYARQGGTPM EIPEILDRVA        60
     RFGCSLVEIT GGEPLLQKET PLLIQRLLSV GYRVLLETNG TQNIGLVDKS CIRIVDVKCP       120
     SSGESEKNDA RNLDRLAAHD QVKFVISDRT DYLFAKKTAG RITAVAPGHI LFSTVHGVLD       180
     PAQLAHWMLA DGLPVRLHLQ LHKILWGEAR GK                                     212
//

If you have problems or comments...

PBIL Back to PBIL home page