(data stored in ACNUC7421 zone)

EMBL: CP000859.PE5

CP000859.PE5         Location/Qualifiers
FT   CDS             complement(4067..5764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0005"
FT                   /product="GTP-binding protein HSR1-related"
FT                   /note="PFAM: GTP-binding protein HSR1-related; KEGG:
FT                   sat:SYN_01762 GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65815"
FT                   /db_xref="GOA:A8ZRP8"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016496"
FT                   /db_xref="InterPro:IPR025121"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030394"
FT                   /db_xref="InterPro:IPR032305"
FT                   /db_xref="InterPro:IPR042108"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRP8"
FT                   /protein_id="ABW65815.1"
FT                   /translation="MKKRPHGNTGGLKADHLRRLDNLYRRRVPSSFLVTPELARELCLL
FT                   SREIRRQIGLLIDRQGVVAHVIVGTDSAIVIPDISEYRTAAGRLRGLKCVHTHLGPDPL
FT                   TADDITDLSLLRLDIMAAVADTGGPEENPRYRVYGAHLLPGNGEGGPSGPSCKVLDPLG
FT                   HADLDIGCDGLIASLEDELAQAGALREAGQKSDRAILVSVTGAPRAAAGASLTELSALA
FT                   ASADIAVVDTVLQFRKKTDARFLLGRGKLGELAVLALQTGANLLVFDQELNPSQIRSIT
FT                   DQVDIKVIDRTQLILDIFAQRAQSMEGKLQVAHAQLKYLLPRLVTKNTAMSRLTGGIGG
FT                   RGPGETKLEINRRRVRDQLARLEKQLESIKKQRRQQKARRDKRALPVISILGYTNAGKS
FT                   TLLNTLSKSGVATADRLFMTLDPASRRIRFPREMDVILTDTVGFIQNLPKELMVAFRAT
FT                   LEELERADLFIHVVDAANPAAEAQIRSVERIVTELGLSLTPMVYAVNKADRATPEQVEA
FT                   LVRATGGVPVSANNAATLGPLIDRLADRVGQIVKHNRRLSENPVISDY"
     MKKRPHGNTG GLKADHLRRL DNLYRRRVPS SFLVTPELAR ELCLLSREIR RQIGLLIDRQ        60
     GVVAHVIVGT DSAIVIPDIS EYRTAAGRLR GLKCVHTHLG PDPLTADDIT DLSLLRLDIM       120
     AAVADTGGPE ENPRYRVYGA HLLPGNGEGG PSGPSCKVLD PLGHADLDIG CDGLIASLED       180
     ELAQAGALRE AGQKSDRAIL VSVTGAPRAA AGASLTELSA LAASADIAVV DTVLQFRKKT       240
     DARFLLGRGK LGELAVLALQ TGANLLVFDQ ELNPSQIRSI TDQVDIKVID RTQLILDIFA       300
     QRAQSMEGKL QVAHAQLKYL LPRLVTKNTA MSRLTGGIGG RGPGETKLEI NRRRVRDQLA       360
     RLEKQLESIK KQRRQQKARR DKRALPVISI LGYTNAGKST LLNTLSKSGV ATADRLFMTL       420
     DPASRRIRFP REMDVILTDT VGFIQNLPKE LMVAFRATLE ELERADLFIH VVDAANPAAE       480
     AQIRSVERIV TELGLSLTPM VYAVNKADRA TPEQVEALVR ATGGVPVSAN NAATLGPLID       540
     RLADRVGQIV KHNRRLSENP VISDY                                             565
//

If you have problems or comments...

PBIL Back to PBIL home page