(data stored in ACNUC7421 zone)

EMBL: CP000859.PE504

CP000859.PE504       Location/Qualifiers
FT   CDS             complement(570872..571330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0504"
FT                   /product="putative PTS IIA-like nitrogen-regulatory protein
FT                   PtsN"
FT                   /note="PFAM: phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system EIIA 2; KEGG: pca:Pcar_1936 PTS
FT                   system, IIA component"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66314"
FT                   /db_xref="GOA:A8ZTQ0"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTQ0"
FT                   /protein_id="ABW66314.1"
FT                   /translation="MKLLDVLRKEAVLVNLEARDKKGVLEELTVPAAKISGIEHSKLVR
FT                   MLMERERLGTTGIGGGIGIPHGKLKELGTVILCAGLSRKGVDFDAMDGRPVHIFFLLFT
FT                   PEGSTELHLMLLSRISKLLKNDIFRQRLADAQDADTVLEIIEEYDEEP"
     MKLLDVLRKE AVLVNLEARD KKGVLEELTV PAAKISGIEH SKLVRMLMER ERLGTTGIGG        60
     GIGIPHGKLK ELGTVILCAG LSRKGVDFDA MDGRPVHIFF LLFTPEGSTE LHLMLLSRIS       120
     KLLKNDIFRQ RLADAQDADT VLEIIEEYDE EP                                     152
//

If you have problems or comments...

PBIL Back to PBIL home page