(data stored in ACNUC7421 zone)

EMBL: CP000859.PE505

CP000859.PE505       Location/Qualifiers
FT   CDS             complement(571510..571845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0505"
FT                   /product="sigma 54 modulation protein/ribosomal protein
FT                   S30EA"
FT                   /note="TIGRFAM: ribosomal subunit interface protein; PFAM:
FT                   sigma 54 modulation protein/ribosomal protein S30EA; KEGG:
FT                   gsu:GSU1886 ribosomal subunit interface protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66315"
FT                   /db_xref="GOA:A8ZTQ1"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTQ1"
FT                   /protein_id="ABW66315.1"
FT                   /translation="MQVTVTFKNLEASEHLKQFVSEKLNKFDRLFDSPAKAEVLLSVEK
FT                   FRNIAEINLTGDKLNIIGKEETEDMYAAIDLVMDKIEKQIKKNKQKIKQHRPATRKAAK
FT                   REDTDLP"
     MQVTVTFKNL EASEHLKQFV SEKLNKFDRL FDSPAKAEVL LSVEKFRNIA EINLTGDKLN        60
     IIGKEETEDM YAAIDLVMDK IEKQIKKNKQ KIKQHRPATR KAAKREDTDL P                111
//

If you have problems or comments...

PBIL Back to PBIL home page