(data stored in ACNUC7421 zone)

EMBL: CP000859.PE506

CP000859.PE506       Location/Qualifiers
FT   CDS             complement(571857..573299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0506"
FT                   /product="RNA polymerase, sigma 54 subunit, RpoN"
FT                   /note="TIGRFAM: RNA polymerase sigma-54 factor, RpoN; PFAM:
FT                   sigma-54 factor; sigma-54 factor core-binding region;
FT                   sigma-54 DNA-binding domain protein; KEGG: ade:Adeh_4167
FT                   sigma-54 (RpoN)"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66316"
FT                   /db_xref="GOA:A8ZTQ2"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="InterPro:IPR038709"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTQ2"
FT                   /protein_id="ABW66316.1"
FT                   /translation="MALDLRQHLKLSQQLVMTPQLQMAIRLLQLNRLEMVDMIQQELSE
FT                   NPALEEAPETAPEDELSTDDREAEALPERVEAEKEVSIEEKISDQVEWENYLNEYNSYG
FT                   GVQFESEAREQPQYESFVASHKSLKDHLLWQFLMTLPTGQEEAIASLIVGNVDDDGYLK
FT                   ADVAEIAATANAPIEQVETILAMLQNFDPPGVCARTLAECLLIQARQLGIDTPVIAGIL
FT                   NNHMKHLESKNYKVIARALKTDTEEIVAAVNLIRTLEPRPGRSFKQEDAGYIIPDIYVH
FT                   KFENDFVIVLNDDDLPRLHISPYYRQAMRGRAAGSKEAKEYLQEKIRSATWLIKSIQQR
FT                   QKTIYAVMNSILKFQRDFFEKGVAHLRPMILRDVAEDIGMHESTISRVTTNKYAHTPQG
FT                   IFELKYFFNSAINRTGADSMASVSVQDKIRQIIKNENPKKPFSDDKIADILKAANINIA
FT                   RRTVTKYREAMGILSSTKRKQF"
     MALDLRQHLK LSQQLVMTPQ LQMAIRLLQL NRLEMVDMIQ QELSENPALE EAPETAPEDE        60
     LSTDDREAEA LPERVEAEKE VSIEEKISDQ VEWENYLNEY NSYGGVQFES EAREQPQYES       120
     FVASHKSLKD HLLWQFLMTL PTGQEEAIAS LIVGNVDDDG YLKADVAEIA ATANAPIEQV       180
     ETILAMLQNF DPPGVCARTL AECLLIQARQ LGIDTPVIAG ILNNHMKHLE SKNYKVIARA       240
     LKTDTEEIVA AVNLIRTLEP RPGRSFKQED AGYIIPDIYV HKFENDFVIV LNDDDLPRLH       300
     ISPYYRQAMR GRAAGSKEAK EYLQEKIRSA TWLIKSIQQR QKTIYAVMNS ILKFQRDFFE       360
     KGVAHLRPMI LRDVAEDIGM HESTISRVTT NKYAHTPQGI FELKYFFNSA INRTGADSMA       420
     SVSVQDKIRQ IIKNENPKKP FSDDKIADIL KAANINIARR TVTKYREAMG ILSSTKRKQF       480
//

If you have problems or comments...

PBIL Back to PBIL home page