(data stored in ACNUC7421 zone)

EMBL: CP000859.PE507

CP000859.PE507       Location/Qualifiers
FT   CDS             complement(573301..574023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0507"
FT                   /product="ABC transporter-related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: gur:Gura_2973 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66317"
FT                   /db_xref="GOA:A8ZTQ3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030921"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTQ3"
FT                   /protein_id="ABW66317.1"
FT                   /translation="MAVLYLRELVKHYSGRPVVNAVSLELESGQVAGLLGPNGAGKTTT
FT                   FYMTVGMIRPDSGAIAVDSDDITGDPMHIRARKGIGYLPQESSVFKKLTVEQNIRAVLE
FT                   YLGLPVAQQVERTHTLLEELGIERLSGQRAGLLSGGERRRLEICRVLATNPAFVLLDEP
FT                   FAGIDPLAVADIQSIIQHLTDRGLGVLVSDHNVRETLGVCDKAYILNNGQIIEAGTPQV
FT                   IAESKTAKSIYLGEGFRL"
     MAVLYLRELV KHYSGRPVVN AVSLELESGQ VAGLLGPNGA GKTTTFYMTV GMIRPDSGAI        60
     AVDSDDITGD PMHIRARKGI GYLPQESSVF KKLTVEQNIR AVLEYLGLPV AQQVERTHTL       120
     LEELGIERLS GQRAGLLSGG ERRRLEICRV LATNPAFVLL DEPFAGIDPL AVADIQSIIQ       180
     HLTDRGLGVL VSDHNVRETL GVCDKAYILN NGQIIEAGTP QVIAESKTAK SIYLGEGFRL       240
//

If you have problems or comments...

PBIL Back to PBIL home page