(data stored in ACNUC7421 zone)

EMBL: CP000859.PE509

CP000859.PE509       Location/Qualifiers
FT   CDS             complement(574634..575206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0509"
FT                   /product="protein of unknown function DUF1239"
FT                   /note="PFAM: protein of unknown function DUF1239; KEGG:
FT                   afw:Anae109_4315 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66319"
FT                   /db_xref="GOA:A8ZU07"
FT                   /db_xref="InterPro:IPR010664"
FT                   /db_xref="InterPro:IPR026265"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU07"
FT                   /protein_id="ABW66319.1"
FT                   /translation="MRYTRPISLFLMITVFAALGAVIYLLVQSRPLSVPPAATEQADTG
FT                   VDISMTGVSQTFVQEGRISHTLTADTASLLARDKKAVFENVTLTFLAEDGTPSVVTAKQ
FT                   GELSTETGDATLSGGVVVENRARKIYAQTLHYNDNRHILYSVEPVVVTGDSFRFTGNSM
FT                   TFDMTSGKAVLSGNVTGRITDDALALQ"
     MRYTRPISLF LMITVFAALG AVIYLLVQSR PLSVPPAATE QADTGVDISM TGVSQTFVQE        60
     GRISHTLTAD TASLLARDKK AVFENVTLTF LAEDGTPSVV TAKQGELSTE TGDATLSGGV       120
     VVENRARKIY AQTLHYNDNR HILYSVEPVV VTGDSFRFTG NSMTFDMTSG KAVLSGNVTG       180
     RITDDALALQ                                                              190
//

If you have problems or comments...

PBIL Back to PBIL home page