(data stored in ACNUC7421 zone)

EMBL: CP000859.PE516

CP000859.PE516       Location/Qualifiers
FT   CDS             581241..582647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0516"
FT                   /product="two component, sigma54 specific, transcriptional
FT                   regulator, Fis family"
FT                   /note="PFAM: response regulator receiver; sigma-54 factor
FT                   interaction domain-containing protein; helix-turn-helix
FT                   Fis-type; ATPase associated with various cellular
FT                   activities AAA_5; SMART: AAA ATPase; KEGG: sfu:Sfum_2092
FT                   two component, sigma54 specific, transcriptional regulator,
FT                   fis family"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66326"
FT                   /db_xref="GOA:A8ZU14"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU14"
FT                   /protein_id="ABW66326.1"
FT                   /translation="MAGAKANILVVDDELSMRELLDVMLSREGYKVACAEDGTQALSML
FT                   GEMKFDLVLCDVRLGDMSGIDVLKAAKKANHDTVVIMISAYATTEVAVAAMNEGAYDFV
FT                   PKPLDSAELKQTIIRSLSLRTVEQERQALDNSLEDHLYFERIVGSHPKMKHIYNMVRQV
FT                   AQTRTRILITGESGTGKELIARAIHEQSDRANHPFVVVNCGGIPENLMESELFGHRKGS
FT                   FTGAVMDKKGLFTIAHKGTIFLDEIGELSMPLQVKLLRVVQDGAFKQVGGTEEISVDAR
FT                   ILSATNKNLSQEVIDGNFREDLFYRLNVIELNVPPLRERKSDIRVLAQFFVEKFSKDLG
FT                   KEVIKLSSYALDMLEKYSFPGNVRELENLIERSVALSTTNIILPESLSLAVHKRRWIEG
FT                   VPGRRFDLEEVTKGVALDEILADIERAYLKKALESSGGNKNRAAELLGISFRSFRYRLD
FT                   KLNVPWDEEE"
     MAGAKANILV VDDELSMREL LDVMLSREGY KVACAEDGTQ ALSMLGEMKF DLVLCDVRLG        60
     DMSGIDVLKA AKKANHDTVV IMISAYATTE VAVAAMNEGA YDFVPKPLDS AELKQTIIRS       120
     LSLRTVEQER QALDNSLEDH LYFERIVGSH PKMKHIYNMV RQVAQTRTRI LITGESGTGK       180
     ELIARAIHEQ SDRANHPFVV VNCGGIPENL MESELFGHRK GSFTGAVMDK KGLFTIAHKG       240
     TIFLDEIGEL SMPLQVKLLR VVQDGAFKQV GGTEEISVDA RILSATNKNL SQEVIDGNFR       300
     EDLFYRLNVI ELNVPPLRER KSDIRVLAQF FVEKFSKDLG KEVIKLSSYA LDMLEKYSFP       360
     GNVRELENLI ERSVALSTTN IILPESLSLA VHKRRWIEGV PGRRFDLEEV TKGVALDEIL       420
     ADIERAYLKK ALESSGGNKN RAAELLGISF RSFRYRLDKL NVPWDEEE                    468
//

If you have problems or comments...

PBIL Back to PBIL home page