(data stored in ACNUC7421 zone)

EMBL: CP000859.PE520

CP000859.PE520       Location/Qualifiers
FT   CDS             586890..587945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0520"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; Male sterility
FT                   domain; KEGG: lbj:LBJ_0629 nucleoside-diphosphate-sugar
FT                   epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66330"
FT                   /db_xref="GOA:A8ZU18"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU18"
FT                   /protein_id="ABW66330.1"
FT                   /translation="MNVLVTGGCGFLGSHVCEYYARRGDQVVSYDNMTKHELERAGFAT
FT                   GKARNHNRDFLAGLGVDLVTADIRDAEQLIDSAAGCDYIVHTAAQPAMTISVEDPALDL
FT                   SSNVMGTFNVLETARRLKVPVASCATIHVYGNRINDTLTEGQARYARQPEAIDEDHPVL
FT                   EGTLTPLHASKAGAELYVRTYIETYGVTAASFRLTGIYGPRQFGGEDHGWVANFAIRSV
FT                   LKRPLTIYGTGKQVRDIVFAGDVCRAFDAFYQKRVPGIYNIGGGPNTAISLLECIALLE
FT                   KLNGEKPDIRFGPDRHGDLRYFVCDVSKARSLLGWRPEVKPEPGIRALLEWIRQNRKCF
FT                   GFTTESKGSLS"
     MNVLVTGGCG FLGSHVCEYY ARRGDQVVSY DNMTKHELER AGFATGKARN HNRDFLAGLG        60
     VDLVTADIRD AEQLIDSAAG CDYIVHTAAQ PAMTISVEDP ALDLSSNVMG TFNVLETARR       120
     LKVPVASCAT IHVYGNRIND TLTEGQARYA RQPEAIDEDH PVLEGTLTPL HASKAGAELY       180
     VRTYIETYGV TAASFRLTGI YGPRQFGGED HGWVANFAIR SVLKRPLTIY GTGKQVRDIV       240
     FAGDVCRAFD AFYQKRVPGI YNIGGGPNTA ISLLECIALL EKLNGEKPDI RFGPDRHGDL       300
     RYFVCDVSKA RSLLGWRPEV KPEPGIRALL EWIRQNRKCF GFTTESKGSL S                351
//

If you have problems or comments...

PBIL Back to PBIL home page