(data stored in ACNUC7421 zone)

EMBL: CP000859.PE529

CP000859.PE529       Location/Qualifiers
FT   CDS             complement(595556..596308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0529"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66339"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU27"
FT                   /protein_id="ABW66339.1"
FT                   /translation="MSNPAVITLAELQGGLAGLDRLQIEDNIGEAIHLHIGPVRLDFTI
FT                   TDFLDLAEGMKKALDATGRFSPYTAEQFDPMFLLTCGSLLAHLEGIDIEERYIDDLRCI
FT                   VYRSRRLGIYTVKPVKQTPAYRFLATGDEKFLCYEQKSYLGMNNKERLVQVVANIENFG
FT                   YPREGRHIILFKGQSIVRDGQHRLAALRHRYGNMKIPVMVFRFSPKATTHLKPWQPYIG
FT                   IVFRLGRICGSRMNNRLKKINKFFKSPP"
     MSNPAVITLA ELQGGLAGLD RLQIEDNIGE AIHLHIGPVR LDFTITDFLD LAEGMKKALD        60
     ATGRFSPYTA EQFDPMFLLT CGSLLAHLEG IDIEERYIDD LRCIVYRSRR LGIYTVKPVK       120
     QTPAYRFLAT GDEKFLCYEQ KSYLGMNNKE RLVQVVANIE NFGYPREGRH IILFKGQSIV       180
     RDGQHRLAAL RHRYGNMKIP VMVFRFSPKA TTHLKPWQPY IGIVFRLGRI CGSRMNNRLK       240
     KINKFFKSPP                                                              250
//

If you have problems or comments...

PBIL Back to PBIL home page