(data stored in ACNUC7421 zone)

EMBL: CP000859.PE530

CP000859.PE530       Location/Qualifiers
FT   CDS             complement(596310..596960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66340"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU28"
FT                   /protein_id="ABW66340.1"
FT                   /translation="MNLIPASHILTFCSAMVDSGPPFRLLRNIDNELPDRLSSGKDIDI
FT                   LVRWQDSEKLEKWMPQAGFHRTPHPFQNEKFLYGVHPFRFYRNNNAPFIIDCHFELACR
FT                   SLNKGEWIPLDQTIQSQAWTSCGYHLVDGLHIPGLNPVCEWIHLLTRCVFDKRRFEKGY
FT                   IRRIDHLMARLNETEMLEISRLVFFKFSMSLLALLQTGRYTEIIREHLHFTDY"
     MNLIPASHIL TFCSAMVDSG PPFRLLRNID NELPDRLSSG KDIDILVRWQ DSEKLEKWMP        60
     QAGFHRTPHP FQNEKFLYGV HPFRFYRNNN APFIIDCHFE LACRSLNKGE WIPLDQTIQS       120
     QAWTSCGYHL VDGLHIPGLN PVCEWIHLLT RCVFDKRRFE KGYIRRIDHL MARLNETEML       180
     EISRLVFFKF SMSLLALLQT GRYTEIIREH LHFTDY                                 216
//

If you have problems or comments...

PBIL Back to PBIL home page