(data stored in ACNUC7421 zone)

EMBL: CP000859.PE536

CP000859.PE536       Location/Qualifiers
FT   CDS             602144..603961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0536"
FT                   /product="type II secretion system protein E"
FT                   /note="PFAM: type II secretion system protein E; General
FT                   secretory system II protein E domain protein; SMART: AAA
FT                   ATPase; KEGG: ppd:Ppro_1060 type II secretion system
FT                   protein E"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66346"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="InterPro:IPR042181"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU34"
FT                   /protein_id="ABW66346.1"
FT                   /translation="MIDDFEKLFAPRKVCQILVARKMISKETAEDLLKRYGGVKSKLEK
FT                   AQSARLAAAPPGIRINNPITIVDVMVSMGLSRADTEVGELDEDAVFQALAEEWDVPFKK
FT                   IDPLKLDLELVTNTIPRSFAMNYLSLPIAVENGELIVATPNPFNTTVMDDIARVVHRRV
FT                   VPVVSTKSDIIRTINEFFGFKKSIAAAETQFAAPTVDLGNLEQYVRLAGEGELPLNDSH
FT                   IVNAVNHLFSYALDQHASDIHIEPKRDITMVRMRIDGVLHTIYKIPKKVHYALVSRIKN
FT                   LARMDMAEKRRPQDGRIKTDKGGSEAEVRVSTIPVAFGEKVVMRIMDPDILFQPLEGLG
FT                   FSAEEMNIYQQMANRPNGIILVCGPTGSGKSTTLYSTLRYLSTPDVNITTVEDPIEMVH
FT                   EDFNQISVQPTVGITFGSILRNILRQDPDIIMIGEMRDLETAQNAIQASLTGHLVLSTL
FT                   HTNDAPSSIIRLLDIGVPNFLVQATLVGVVSQRLVRRICPYCREPIEIDAAEFETMGIQ
FT                   TGKRGKLKLYKGKGCTKCRGTGYKGRTGIFELLPYTEAIRALTLPQTDMAKIQAKSREE
FT                   GMMTLREAAVKKMLRGETTYQEVLRVTWE"
     MIDDFEKLFA PRKVCQILVA RKMISKETAE DLLKRYGGVK SKLEKAQSAR LAAAPPGIRI        60
     NNPITIVDVM VSMGLSRADT EVGELDEDAV FQALAEEWDV PFKKIDPLKL DLELVTNTIP       120
     RSFAMNYLSL PIAVENGELI VATPNPFNTT VMDDIARVVH RRVVPVVSTK SDIIRTINEF       180
     FGFKKSIAAA ETQFAAPTVD LGNLEQYVRL AGEGELPLND SHIVNAVNHL FSYALDQHAS       240
     DIHIEPKRDI TMVRMRIDGV LHTIYKIPKK VHYALVSRIK NLARMDMAEK RRPQDGRIKT       300
     DKGGSEAEVR VSTIPVAFGE KVVMRIMDPD ILFQPLEGLG FSAEEMNIYQ QMANRPNGII       360
     LVCGPTGSGK STTLYSTLRY LSTPDVNITT VEDPIEMVHE DFNQISVQPT VGITFGSILR       420
     NILRQDPDII MIGEMRDLET AQNAIQASLT GHLVLSTLHT NDAPSSIIRL LDIGVPNFLV       480
     QATLVGVVSQ RLVRRICPYC REPIEIDAAE FETMGIQTGK RGKLKLYKGK GCTKCRGTGY       540
     KGRTGIFELL PYTEAIRALT LPQTDMAKIQ AKSREEGMMT LREAAVKKML RGETTYQEVL       600
     RVTWE                                                                   605
//

If you have problems or comments...

PBIL Back to PBIL home page