(data stored in ACNUC7421 zone)

EMBL: CP000859.PE539

CP000859.PE539       Location/Qualifiers
FT   CDS             complement(606242..606712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0539"
FT                   /product="protein of unknown function UPF0153"
FT                   /note="PFAM: protein of unknown function UPF0153; KEGG:
FT                   dde:Dde_1303 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66349"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU37"
FT                   /protein_id="ABW66349.1"
FT                   /translation="MPSDHTQPEEIFECKQCGDCCRGYGGTFVTPEDIAAISAYVHTDP
FT                   KEFVEKWCAFSGSRPVLAQKADGYCVFWDRVCTIHPVKPRMCRAWPYIESVMIDPGNWE
FT                   IMSSMCPGIKTGVGPETIRACVRRHLADLPPAGSRHLEQPVSEGRSTNDRHL"
     MPSDHTQPEE IFECKQCGDC CRGYGGTFVT PEDIAAISAY VHTDPKEFVE KWCAFSGSRP        60
     VLAQKADGYC VFWDRVCTIH PVKPRMCRAW PYIESVMIDP GNWEIMSSMC PGIKTGVGPE       120
     TIRACVRRHL ADLPPAGSRH LEQPVSEGRS TNDRHL                                 156
//

If you have problems or comments...

PBIL Back to PBIL home page