(data stored in ACNUC7421 zone)

EMBL: CP000859.PE541

CP000859.PE541       Location/Qualifiers
FT   CDS             complement(607301..607612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0541"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   sat:SYN_00162 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66351"
FT                   /db_xref="GOA:A8ZU39"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU39"
FT                   /protein_id="ABW66351.1"
FT                   /translation="MKNMGGMLKQAQKLQAQMVKLQEELAEKTVEATAGGGMVKATANG
FT                   RQQITALVIEKEVVDPADVEMLQDLVLAAINDALTKSQEMMNSEMGKLTGGLNIPGLM"
     MKNMGGMLKQ AQKLQAQMVK LQEELAEKTV EATAGGGMVK ATANGRQQIT ALVIEKEVVD        60
     PADVEMLQDL VLAAINDALT KSQEMMNSEM GKLTGGLNIP GLM                         103
//

If you have problems or comments...

PBIL Back to PBIL home page