(data stored in ACNUC7421 zone)

EMBL: CP000859.PE56

CP000859.PE56        Location/Qualifiers
FT   CDS             63436..63921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0056"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65866"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRU9"
FT                   /protein_id="ABW65866.1"
FT                   /translation="MARKVTISVPEDLYEKMSKWRDSFNFSNVFQKAISTLIQKKEDFQ
FT                   SRIQQELDQSAVIERLRQEKSQSENNYYDVGRKDGLKWAKNAHYDDLQYALRWVPDEKP
FT                   TQDRVLGDYFAGVIAGDDIMDYAVGSDPVCVNEFVKTYIDGWKEGISDFWHEIRDKL"
     MARKVTISVP EDLYEKMSKW RDSFNFSNVF QKAISTLIQK KEDFQSRIQQ ELDQSAVIER        60
     LRQEKSQSEN NYYDVGRKDG LKWAKNAHYD DLQYALRWVP DEKPTQDRVL GDYFAGVIAG       120
     DDIMDYAVGS DPVCVNEFVK TYIDGWKEGI SDFWHEIRDK L                           161
//

If you have problems or comments...

PBIL Back to PBIL home page